SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5trwa_ (5trw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137653Family c.72.1.5: PfkB-like kinase [82515] (3 protein domains)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 2137682Protein automated matches [190479] (3 species)
    not a true protein
  7. 2282806Species Burkholderia xenovorans [TaxId:266265] [326107] (1 PDB entry)
  8. 2282807Domain d5trwa_: 5trw A: [326108]
    automated match to d1td2a_
    complexed with cl, edo, nhe, no3, so4

Details for d5trwa_

PDB Entry: 5trw (more details), 1.6 Å

PDB Description: crystal structure of pyridoxamine kinase pdxy from burkholderia xenovorans
PDB Compounds: (A:) Pyridoxal kinase PdxY

SCOPe Domain Sequences for d5trwa_:

Sequence, based on SEQRES records: (download)

>d5trwa_ c.72.1.5 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mtknvlsiqshvvfghagnsaavfpmrrlgvnvwplntvqfsnhtqyghwtggaidatqm
velvdgigaigmlprcdavlsgylgtpeqaqsvleivkavkaanprawyfcdpvmgavsg
ckvepgiqeflvrtmpgvadamapnhtelqrlvgreietleeavtacreliargpklvlv
khlldrnspadrfnmlvvtereawmgqrplypfarqpvgvgdltsavfvartllgdsira
afehtlaavnavvkatwqagryelelvaaqseiaqprewfdawvgd

Sequence, based on observed residues (ATOM records): (download)

>d5trwa_ c.72.1.5 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mtknvlsiqshvvfghagnsaavfpmrrlgvnvwplntvqfsnhtqyghwtggaidatqm
velvdgigaigmlprcdavlsgylgtpeqaqsvleivkavkaanprawyfcdpvmepgiq
eflvrtmpgvadamapnhtelqrlvgreietleeavtacreliargpklvlvkhlldrns
padrfnmlvvtereawmgqrplypfarqpvgvgdltsavfvartllgdsiraafehtlaa
vnavvkatwqagryelelvaaqseiaqprewfdawvgd

SCOPe Domain Coordinates for d5trwa_:

Click to download the PDB-style file with coordinates for d5trwa_.
(The format of our PDB-style files is described here.)

Timeline for d5trwa_:

  • d5trwa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13