Lineage for d5trwa_ (5trw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137653Family c.72.1.5: PfkB-like kinase [82515] (3 protein domains)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 2137682Protein automated matches [190479] (3 species)
    not a true protein
  7. 2282806Species Burkholderia xenovorans [TaxId:266265] [326107] (1 PDB entry)
  8. 2282807Domain d5trwa_: 5trw A: [326108]
    automated match to d1td2a_
    complexed with cl, edo, nhe, no3, so4

Details for d5trwa_

PDB Entry: 5trw (more details), 1.6 Å

PDB Description: crystal structure of pyridoxamine kinase pdxy from burkholderia xenovorans
PDB Compounds: (A:) Pyridoxal kinase PdxY

SCOPe Domain Sequences for d5trwa_:

Sequence, based on SEQRES records: (download)

>d5trwa_ c.72.1.5 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mtknvlsiqshvvfghagnsaavfpmrrlgvnvwplntvqfsnhtqyghwtggaidatqm
velvdgigaigmlprcdavlsgylgtpeqaqsvleivkavkaanprawyfcdpvmgavsg
ckvepgiqeflvrtmpgvadamapnhtelqrlvgreietleeavtacreliargpklvlv
khlldrnspadrfnmlvvtereawmgqrplypfarqpvgvgdltsavfvartllgdsira
afehtlaavnavvkatwqagryelelvaaqseiaqprewfdawvgd

Sequence, based on observed residues (ATOM records): (download)

>d5trwa_ c.72.1.5 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mtknvlsiqshvvfghagnsaavfpmrrlgvnvwplntvqfsnhtqyghwtggaidatqm
velvdgigaigmlprcdavlsgylgtpeqaqsvleivkavkaanprawyfcdpvmepgiq
eflvrtmpgvadamapnhtelqrlvgreietleeavtacreliargpklvlvkhlldrns
padrfnmlvvtereawmgqrplypfarqpvgvgdltsavfvartllgdsiraafehtlaa
vnavvkatwqagryelelvaaqseiaqprewfdawvgd

SCOPe Domain Coordinates for d5trwa_:

Click to download the PDB-style file with coordinates for d5trwa_.
(The format of our PDB-style files is described here.)

Timeline for d5trwa_:

  • d5trwa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13