SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m1ia2 (5m1i A:178-525)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083644Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 protein domains)
    Pfam PF01055
  6. 2083693Protein automated matches [310869] (2 species)
    not a true protein
  7. 2282707Species Thermotoga maritima [TaxId:2336] [326008] (4 PDB entries)
  8. 2282803Domain d5m1ia2: 5m1i A:178-525 [326104]
    Other proteins in same PDB: d5m1ia1, d5m1ia3
    automated match to d1zy9a2
    complexed with 7d8, edo, so4

Details for d5m1ia2

PDB Entry: 5m1i (more details), 1.55 Å

PDB Description: structure of gh36 alpha-galactosidase from thermotoga maritima in a covalent complex with a cyclopropyl carbasugar.
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d5m1ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m1ia2 c.1.8.13 (A:178-525) automated matches {Thermotoga maritima [TaxId: 2336]}
rvpkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdigdwlvtrgdf
psveemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmayrnwnkkiya
ldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqafrkgietirk
avgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrnaitryfm
hdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgkkvlket
lellggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhleke

SCOPe Domain Coordinates for d5m1ia2:

Click to download the PDB-style file with coordinates for d5m1ia2.
(The format of our PDB-style files is described here.)

Timeline for d5m1ia2:

  • d5m1ia2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13