Lineage for d5toza_ (5toz A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (825 PDB entries)
  8. 2282797Domain d5toza_: 5toz A: [326098]
    automated match to d4e4ma_
    complexed with 7h4, so4

Details for d5toza_

PDB Entry: 5toz (more details), 1.98 Å

PDB Description: jak3 with covalent inhibitor pf-06651600
PDB Compounds: (A:) Tyrosine-protein kinase JAK3

SCOPe Domain Sequences for d5toza_:

Sequence, based on SEQRES records: (download)

>d5toza_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfqreiqi
lkalhsdfivkyrgvsygpgrqslrlvmeylpsgclrdflqrhrarldasrlllyssqic
kgmeylgsrrcvhrdlaarnilveseahvkiadfglakllpldkdyyvvrepgqspifwy
apeslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgcerdvpalsrllell
eegqrlpappacpaevhelmklcwapspqdrpsfsalgpqldmlws

Sequence, based on observed residues (ATOM records): (download)

>d5toza_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfqreiqi
lkalhsdfivkyrgvsygslrlvmeylpsgclrdflqrhrarldasrlllyssqickgme
ylgsrrcvhrdlaarnilveseahvkiadfglakllpldkdyyvvrepgqspifwyapes
lsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmdvpalsrllelleegqrlpa
ppacpaevhelmklcwapspqdrpsfsalgpqldmlws

SCOPe Domain Coordinates for d5toza_:

Click to download the PDB-style file with coordinates for d5toza_.
(The format of our PDB-style files is described here.)

Timeline for d5toza_:

  • d5toza_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13