SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5toza_ (5toz A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (778 PDB entries)
  8. 2282797Domain d5toza_: 5toz A: [326098]
    automated match to d4e4ma_
    complexed with 7h4, so4

Details for d5toza_

PDB Entry: 5toz (more details), 1.98 Å

PDB Description: jak3 with covalent inhibitor pf-06651600
PDB Compounds: (A:) Tyrosine-protein kinase JAK3

SCOPe Domain Sequences for d5toza_:

Sequence, based on SEQRES records: (download)

>d5toza_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfqreiqi
lkalhsdfivkyrgvsygpgrqslrlvmeylpsgclrdflqrhrarldasrlllyssqic
kgmeylgsrrcvhrdlaarnilveseahvkiadfglakllpldkdyyvvrepgqspifwy
apeslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgcerdvpalsrllell
eegqrlpappacpaevhelmklcwapspqdrpsfsalgpqldmlws

Sequence, based on observed residues (ATOM records): (download)

>d5toza_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfqreiqi
lkalhsdfivkyrgvsygslrlvmeylpsgclrdflqrhrarldasrlllyssqickgme
ylgsrrcvhrdlaarnilveseahvkiadfglakllpldkdyyvvrepgqspifwyapes
lsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmdvpalsrllelleegqrlpa
ppacpaevhelmklcwapspqdrpsfsalgpqldmlws

SCOPe Domain Coordinates for d5toza_:

Click to download the PDB-style file with coordinates for d5toza_.
(The format of our PDB-style files is described here.)

Timeline for d5toza_:

  • d5toza_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13