Lineage for d5troa1 (5tro A:61-242)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210992Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 2210993Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 2211023Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 2211024Protein automated matches [226981] (10 species)
    not a true protein
  7. 2282791Species Staphylococcus aureus [TaxId:93062] [326092] (1 PDB entry)
  8. 2282795Domain d5troa1: 5tro A:61-242 [326096]
    Other proteins in same PDB: d5troa2, d5trob2
    automated match to d4oola1
    complexed with cl

Details for d5troa1

PDB Entry: 5tro (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of dimerization and transpeptidase domains (residues 39-608) of penicillin-binding protein 1 from staphylococcus aureus.
PDB Compounds: (A:) Penicillin-binding protein 1

SCOPe Domain Sequences for d5troa1:

Sequence, based on SEQRES records: (download)

>d5troa1 d.175.1.0 (A:61-242) automated matches {Staphylococcus aureus [TaxId: 93062]}
qqpergkiydrngkvlaedveryklvavidkkasanskkprhvvdkketakklstvinmk
peeiekrlsqkkafqiefgrkgtnltyqdklkiekmnlpgisllpeterfypngnfashl
igraqknpdtgelkgalgvekifdsylsgskgslryihdiwgyiapntkkekqpkrgddv
hl

Sequence, based on observed residues (ATOM records): (download)

>d5troa1 d.175.1.0 (A:61-242) automated matches {Staphylococcus aureus [TaxId: 93062]}
qqpergkiydrngkvlaedveryklvavidkkasanskkprhvvdkketakklstvinmk
peeiekrlsqkkafqiefgrkgtnltyqdklkiekmnlpgisllpeterfypngnfashl
igraqknpdtgelkgalgvekifdsylsgkrgddvhl

SCOPe Domain Coordinates for d5troa1:

Click to download the PDB-style file with coordinates for d5troa1.
(The format of our PDB-style files is described here.)

Timeline for d5troa1:

  • d5troa1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5troa2