SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5troa1 (5tro A:61-242)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210992Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 2210993Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 2211023Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 2211024Protein automated matches [226981] (10 species)
    not a true protein
  7. 2282791Species Staphylococcus aureus [TaxId:93062] [326092] (1 PDB entry)
  8. 2282795Domain d5troa1: 5tro A:61-242 [326096]
    Other proteins in same PDB: d5troa2, d5trob2
    automated match to d4oola1
    complexed with cl

Details for d5troa1

PDB Entry: 5tro (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of dimerization and transpeptidase domains (residues 39-608) of penicillin-binding protein 1 from staphylococcus aureus.
PDB Compounds: (A:) Penicillin-binding protein 1

SCOPe Domain Sequences for d5troa1:

Sequence, based on SEQRES records: (download)

>d5troa1 d.175.1.0 (A:61-242) automated matches {Staphylococcus aureus [TaxId: 93062]}
qqpergkiydrngkvlaedveryklvavidkkasanskkprhvvdkketakklstvinmk
peeiekrlsqkkafqiefgrkgtnltyqdklkiekmnlpgisllpeterfypngnfashl
igraqknpdtgelkgalgvekifdsylsgskgslryihdiwgyiapntkkekqpkrgddv
hl

Sequence, based on observed residues (ATOM records): (download)

>d5troa1 d.175.1.0 (A:61-242) automated matches {Staphylococcus aureus [TaxId: 93062]}
qqpergkiydrngkvlaedveryklvavidkkasanskkprhvvdkketakklstvinmk
peeiekrlsqkkafqiefgrkgtnltyqdklkiekmnlpgisllpeterfypngnfashl
igraqknpdtgelkgalgvekifdsylsgkrgddvhl

SCOPe Domain Coordinates for d5troa1:

Click to download the PDB-style file with coordinates for d5troa1.
(The format of our PDB-style files is described here.)

Timeline for d5troa1:

  • d5troa1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5troa2