Lineage for d5trob2 (5tro B:243-589)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245750Species Staphylococcus aureus [TaxId:93062] [326094] (1 PDB entry)
  8. 2245752Domain d5trob2: 5tro B:243-589 [326095]
    Other proteins in same PDB: d5troa1, d5trob1
    automated match to d4oola2
    complexed with cl

Details for d5trob2

PDB Entry: 5tro (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of dimerization and transpeptidase domains (residues 39-608) of penicillin-binding protein 1 from staphylococcus aureus.
PDB Compounds: (B:) Penicillin-binding protein 1

SCOPe Domain Sequences for d5trob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5trob2 e.3.1.0 (B:243-589) automated matches {Staphylococcus aureus [TaxId: 93062]}
tidsniqvfveealdgmveryqpkdlfavvmdaktgeilaysqrptfnpetgkdfgkkwa
ndlyqntyepgstfksyglaaaiqegafdpdkkyksghrdimgsrisdwnrvgwgeipms
lgftyssntlmmhlqdlvgadkmkswyerfgfgkstkgmfdgeapgqigwsnelqqktss
fgqsttvtpvqmlqaqsaffndgnmlkpwfvnsvenpvskrqfykgqkqiagkpitkdta
ekvekqldlvvnskkshaanyridgyevegktgtaqvaapngggyvkgpnpyfvsfmgda
pkknpkvivyagmslaqkndqeayelgvskafkpimentlkylnvgk

SCOPe Domain Coordinates for d5trob2:

Click to download the PDB-style file with coordinates for d5trob2.
(The format of our PDB-style files is described here.)

Timeline for d5trob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5trob1