SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5trob2 (5tro B:243-589)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (39 species)
    not a true protein
  7. 2282793Species Staphylococcus aureus [TaxId:93062] [326094] (1 PDB entry)
  8. 2282794Domain d5trob2: 5tro B:243-589 [326095]
    Other proteins in same PDB: d5troa1, d5trob1
    automated match to d4oola2
    complexed with cl

Details for d5trob2

PDB Entry: 5tro (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of dimerization and transpeptidase domains (residues 39-608) of penicillin-binding protein 1 from staphylococcus aureus.
PDB Compounds: (B:) Penicillin-binding protein 1

SCOPe Domain Sequences for d5trob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5trob2 e.3.1.0 (B:243-589) automated matches {Staphylococcus aureus [TaxId: 93062]}
tidsniqvfveealdgmveryqpkdlfavvmdaktgeilaysqrptfnpetgkdfgkkwa
ndlyqntyepgstfksyglaaaiqegafdpdkkyksghrdimgsrisdwnrvgwgeipms
lgftyssntlmmhlqdlvgadkmkswyerfgfgkstkgmfdgeapgqigwsnelqqktss
fgqsttvtpvqmlqaqsaffndgnmlkpwfvnsvenpvskrqfykgqkqiagkpitkdta
ekvekqldlvvnskkshaanyridgyevegktgtaqvaapngggyvkgpnpyfvsfmgda
pkknpkvivyagmslaqkndqeayelgvskafkpimentlkylnvgk

SCOPe Domain Coordinates for d5trob2:

Click to download the PDB-style file with coordinates for d5trob2.
(The format of our PDB-style files is described here.)

Timeline for d5trob2:

  • d5trob2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5trob1