SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tr9b2 (5tr9 B:115-267)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105127Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2105128Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2105290Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2105291Protein automated matches [226871] (18 species)
    not a true protein
  7. 2281011Species Neisseria gonorrhoeae [TaxId:1351790] [324312] (2 PDB entries)
  8. 2282790Domain d5tr9b2: 5tr9 B:115-267 [326091]
    Other proteins in same PDB: d5tr9a1, d5tr9b1
    automated match to d3fpka2
    complexed with cl, edo, fad, mg, na

Details for d5tr9b2

PDB Entry: 5tr9 (more details), 1.65 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound fad
PDB Compounds: (B:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d5tr9b2:

Sequence, based on SEQRES records: (download)

>d5tr9b2 c.25.1.0 (B:115-267) automated matches {Neisseria gonorrhoeae [TaxId: 1351790]}
erfpdgkdlvmlctgsgiapflsileqpeirqrfdtvnlihsvsfpeelifndrlaalse
hplvgeyghsfrfvpvttraanpsglsgkripellknnsieqalhtkltpestrfmicgn
pemvkdtfqtlldmgyamhrnripgqimmengf

Sequence, based on observed residues (ATOM records): (download)

>d5tr9b2 c.25.1.0 (B:115-267) automated matches {Neisseria gonorrhoeae [TaxId: 1351790]}
erfpdgkdlvmlctgsgiapflsileqpeirqrfdtvnlihsvsfpeelifndrlaalse
hsfrfvpvttraanpsglsgkripellknnsieqalhtkltpestrfmicgnpemvkdtf
qtlldmgyamhrnripgqimmengf

SCOPe Domain Coordinates for d5tr9b2:

Click to download the PDB-style file with coordinates for d5tr9b2.
(The format of our PDB-style files is described here.)

Timeline for d5tr9b2:

  • d5tr9b2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5tr9b1