Lineage for d5trfb_ (5trf B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712372Protein MDM2 [47594] (2 species)
  7. 2712390Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)
  8. 2712502Domain d5trfb_: 5trf B: [326089]
    automated match to d2lzga_
    complexed with 7hc, gol, so4

Details for d5trfb_

PDB Entry: 5trf (more details), 2.1 Å

PDB Description: mdm2 in complex with sar405838
PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5trfb_:

Sequence, based on SEQRES records: (download)

>d5trfb_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyde
kqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnq

Sequence, based on observed residues (ATOM records): (download)

>d5trfb_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyqq
hivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnq

SCOPe Domain Coordinates for d5trfb_:

Click to download the PDB-style file with coordinates for d5trfb_.
(The format of our PDB-style files is described here.)

Timeline for d5trfb_: