SCOPe 2.07: Domain d5l64h_: 5l64 H:

Lineage for d5l64h_ (5l64 H:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)

6. Protein automated matches [190144] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (156 PDB entries)

8. Domain d5l64h_: 5l64 H: [326087]
   Other proteins in same PDB: d5l64a_, d5l64c_, d5l64d_, d5l64e_, d5l64g_, d5l64i_, d5l64j_, d5l64k_, d5l64l_, d5l64n_, d5l64o_, d5l64q_, d5l64r_, d5l64s_, d5l64u_, d5l64w_, d5l64x_, d5l64y_, d5l64z_
   automated match to d4r17h_
   complexed with 6nv, cl, mes, mg

Details for d5l64h_

PDB Entry: 5l64, 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 18

PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l64h_:

Sequence; same for both SEQRES and ATOM records:

>d5l64h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

Timeline for d5l64h_:

• d5l64h_ first appeared in SCOPe 2.06