![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 protein domains) |
![]() | Protein automated matches [190144] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (156 PDB entries) |
![]() | Domain d5l64h_: 5l64 H: [326087] Other proteins in same PDB: d5l64a_, d5l64c_, d5l64d_, d5l64e_, d5l64g_, d5l64i_, d5l64j_, d5l64k_, d5l64l_, d5l64n_, d5l64o_, d5l64q_, d5l64r_, d5l64s_, d5l64u_, d5l64w_, d5l64x_, d5l64y_, d5l64z_ automated match to d4r17h_ complexed with 6nv, cl, mes, mg |
PDB Entry: 5l64 (more details), 2.7 Å
SCOPe Domain Sequences for d5l64h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l64h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5l64h_: