SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6ja_ (5t6j A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215948Fold d.300: Kinetochore globular domain-like [143025] (1 superfamily)
    core: alpha-beta(3)-alpha; variant: alpha-beta(4)-alpha(2)
  4. 2215949Superfamily d.300.1: Kinetochore globular domain [143026] (2 families) (S)
    swapped heterodimer with the N-terminal helices; Spc24-like subunits have the core fold, whereas Spc25-like subunits have a variant fold
  5. 2215955Family d.300.1.2: Spc24-like [143030] (1 protein)
    Pfam PF08286
  6. 2215956Protein Kinetochore protein Spc24 [143031] (2 species)
  7. 2282771Species Saccharomyces cerevisiae [TaxId:559292] [326072] (1 PDB entry)
  8. 2282772Domain d5t6ja_: 5t6j A: [326073]
    Other proteins in same PDB: d5t6jb1, d5t6jb2
    automated match to d2ftxb1

Details for d5t6ja_

PDB Entry: 5t6j (more details), 1.75 Å

PDB Description: structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
PDB Compounds: (A:) Kinetochore protein SPC24

SCOPe Domain Sequences for d5t6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6ja_ d.300.1.2 (A:) Kinetochore protein Spc24 {Saccharomyces cerevisiae [TaxId: 559292]}
anenilklklyrslgvildlendqvlinrkndgnidilpldnnlsdfyktkyiwerlgk

SCOPe Domain Coordinates for d5t6ja_:

Click to download the PDB-style file with coordinates for d5t6ja_.
(The format of our PDB-style files is described here.)

Timeline for d5t6ja_:

  • d5t6ja_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13