Lineage for d5t6ja_ (5t6j A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215948Fold d.300: Kinetochore globular domain-like [143025] (1 superfamily)
    core: alpha-beta(3)-alpha; variant: alpha-beta(4)-alpha(2)
  4. 2215949Superfamily d.300.1: Kinetochore globular domain [143026] (2 families) (S)
    swapped heterodimer with the N-terminal helices; Spc24-like subunits have the core fold, whereas Spc25-like subunits have a variant fold
  5. 2215955Family d.300.1.2: Spc24-like [143030] (1 protein)
    Pfam PF08286
  6. 2215956Protein Kinetochore protein Spc24 [143031] (2 species)
  7. 2282771Species Saccharomyces cerevisiae [TaxId:559292] [326072] (1 PDB entry)
  8. 2282772Domain d5t6ja_: 5t6j A: [326073]
    Other proteins in same PDB: d5t6jb1, d5t6jb2
    automated match to d2ftxb1

Details for d5t6ja_

PDB Entry: 5t6j (more details), 1.75 Å

PDB Description: structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
PDB Compounds: (A:) Kinetochore protein SPC24

SCOPe Domain Sequences for d5t6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6ja_ d.300.1.2 (A:) Kinetochore protein Spc24 {Saccharomyces cerevisiae [TaxId: 559292]}
anenilklklyrslgvildlendqvlinrkndgnidilpldnnlsdfyktkyiwerlgk

SCOPe Domain Coordinates for d5t6ja_:

Click to download the PDB-style file with coordinates for d5t6ja_.
(The format of our PDB-style files is described here.)

Timeline for d5t6ja_:

  • d5t6ja_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13