Lineage for d5ltta_ (5ltt A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2550699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (175 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2551987Domain d5ltta_: 5ltt A: [326071]
    Other proteins in same PDB: d5lttb_, d5lttc_, d5lttd_, d5ltte_, d5lttf_, d5lttg_, d5ltth_, d5lttk_, d5lttm_, d5lttp_, d5lttq_, d5lttr_, d5ltts_, d5lttt_, d5lttu_, d5lttv_, d5ltty_
    automated match to d1jd2v_
    complexed with 39v, cl, mes, mg

Details for d5ltta_

PDB Entry: 5ltt (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; r57t)in complex with pr-924
PDB Compounds: (A:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d5ltta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltta_ d.153.1.4 (A:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d5ltta_:

Click to download the PDB-style file with coordinates for d5ltta_.
(The format of our PDB-style files is described here.)

Timeline for d5ltta_: