SCOPe 2.08: Domain d5t6jb1: 5t6j B:133-221

Lineage for d5t6jb1 (5t6j B:133-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.300: Kinetochore globular domain-like [143025] (1 superfamily)
   core: alpha-beta(3)-alpha; variant: alpha-beta(4)-alpha(2)

4. Superfamily d.300.1: Kinetochore globular domain [143026] (2 families)
   swapped heterodimer with the N-terminal helices; Spc24-like subunits have the core fold, whereas Spc25-like subunits have a variant fold

5. Family d.300.1.1: Spc25-like [143027] (2 proteins)
   Pfam PF08234

6. Protein automated matches [326065] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [326066] (1 PDB entry)

8. Domain d5t6jb1: 5t6j B:133-221 [326067]
   Other proteins in same PDB: d5t6ja_, d5t6jb2
   automated match to d2ftxa1

Details for d5t6jb1

PDB Entry: 5t6j, 1.75 Å

PDB Description: structure of the mind complex shows a regulatory focus of yeast kinetochore assembly

PDB Compounds: (B:) Kinetochore protein SPC25

SCOPe Domain Sequences for d5t6jb1:

Sequence; same for both SEQRES and ATOM records:

>d5t6jb1 d.300.1.1 (B:133-221) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ndaaevalyerllqlrvlpgasdvhdvrfvfgddsrcwievamhgdhvignshpaldpks
ratlehvltvqgdlaaflvvardmllasl

Timeline for d5t6jb1:

• d5t6jb1 first appeared in SCOPe 2.06
  
• d5t6jb1 appears in SCOPe 2.07