Lineage for d5t6jb1 (5t6j B:133-221)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215948Fold d.300: Kinetochore globular domain-like [143025] (1 superfamily)
    core: alpha-beta(3)-alpha; variant: alpha-beta(4)-alpha(2)
  4. 2215949Superfamily d.300.1: Kinetochore globular domain [143026] (2 families) (S)
    swapped heterodimer with the N-terminal helices; Spc24-like subunits have the core fold, whereas Spc25-like subunits have a variant fold
  5. 2215950Family d.300.1.1: Spc25-like [143027] (2 protein domains)
    Pfam PF08234
  6. 2282764Protein automated matches [326065] (1 species)
    not a true protein
  7. 2282765Species Saccharomyces cerevisiae [TaxId:559292] [326066] (1 PDB entry)
  8. 2282766Domain d5t6jb1: 5t6j B:133-221 [326067]
    Other proteins in same PDB: d5t6ja_, d5t6jb2
    automated match to d2ftxa1

Details for d5t6jb1

PDB Entry: 5t6j (more details), 1.75 Å

PDB Description: structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
PDB Compounds: (B:) Kinetochore protein SPC25

SCOPe Domain Sequences for d5t6jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6jb1 d.300.1.1 (B:133-221) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
ndaaevalyerllqlrvlpgasdvhdvrfvfgddsrcwievamhgdhvignshpaldpks
ratlehvltvqgdlaaflvvardmllasl

SCOPe Domain Coordinates for d5t6jb1:

Click to download the PDB-style file with coordinates for d5t6jb1.
(The format of our PDB-style files is described here.)

Timeline for d5t6jb1:

  • d5t6jb1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5t6jb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5t6ja_