SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6jb1 (5t6j B:133-221)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215948Fold d.300: Kinetochore globular domain-like [143025] (1 superfamily)
    core: alpha-beta(3)-alpha; variant: alpha-beta(4)-alpha(2)
  4. 2215949Superfamily d.300.1: Kinetochore globular domain [143026] (2 families) (S)
    swapped heterodimer with the N-terminal helices; Spc24-like subunits have the core fold, whereas Spc25-like subunits have a variant fold
  5. 2215950Family d.300.1.1: Spc25-like [143027] (2 protein domains)
    Pfam PF08234
  6. 2282764Protein automated matches [326065] (1 species)
    not a true protein
  7. 2282765Species Saccharomyces cerevisiae [TaxId:559292] [326066] (1 PDB entry)
  8. 2282766Domain d5t6jb1: 5t6j B:133-221 [326067]
    Other proteins in same PDB: d5t6ja_, d5t6jb2
    automated match to d2ftxa1

Details for d5t6jb1

PDB Entry: 5t6j (more details), 1.75 Å

PDB Description: structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
PDB Compounds: (B:) Kinetochore protein SPC25

SCOPe Domain Sequences for d5t6jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6jb1 d.300.1.1 (B:133-221) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
ndaaevalyerllqlrvlpgasdvhdvrfvfgddsrcwievamhgdhvignshpaldpks
ratlehvltvqgdlaaflvvardmllasl

SCOPe Domain Coordinates for d5t6jb1:

Click to download the PDB-style file with coordinates for d5t6jb1.
(The format of our PDB-style files is described here.)

Timeline for d5t6jb1:

  • d5t6jb1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5t6jb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5t6ja_