Lineage for d5lscb_ (5lsc B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2205701Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2205847Protein automated matches [190079] (9 species)
    not a true protein
  7. 2205890Species Pseudomonas aeruginosa [TaxId:287] [189349] (34 PDB entries)
  8. 2282753Domain d5lscb_: 5lsc B: [326054]
    automated match to d5a87b_
    complexed with 752, cl, zn

Details for d5lscb_

PDB Entry: 5lsc (more details), 1.5 Å

PDB Description: the structure of the metallo-beta-lactamase vim-2 in complex with a triazolylthioacetamide inhibitor
PDB Compounds: (B:) Metallo-beta-lactamase VIM-2-like protein

SCOPe Domain Sequences for d5lscb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lscb_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawga
kntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegne
ipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsag
nvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsv

SCOPe Domain Coordinates for d5lscb_:

Click to download the PDB-style file with coordinates for d5lscb_.
(The format of our PDB-style files is described here.)

Timeline for d5lscb_:

  • d5lscb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13