SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m7qb_ (5m7q B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2019635Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (30 PDB entries)
  8. 2282750Domain d5m7qb_: 5m7q B: [326051]
    Other proteins in same PDB: d5m7qa2
    automated match to d1mqkh_
    complexed with cl, mg, so4

Details for d5m7qb_

PDB Entry: 5m7q (more details), 1.8 Å

PDB Description: engineering the thermostability of nanobodies - nbd2
PDB Compounds: (B:) Nanobody NbD2

SCOPe Domain Sequences for d5m7qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m7qb_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesgggsvqaggslrlscavsentgrmgwfrqapgkerekvaiitrlggytsyagp
vkgrftisqdnakntvyllmnslkpedtaiyycaadsrpiysgtwrywgqgtqvtvssa

SCOPe Domain Coordinates for d5m7qb_:

Click to download the PDB-style file with coordinates for d5m7qb_.
(The format of our PDB-style files is described here.)

Timeline for d5m7qb_:

  • d5m7qb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13