SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m0xa1 (5m0x A:1-177)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045154Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2045155Protein automated matches [226849] (7 species)
    not a true protein
  7. 2282705Species Thermotoga maritima [TaxId:2336] [326006] (4 PDB entries)
  8. 2282747Domain d5m0xa1: 5m0x A:1-177 [326048]
    Other proteins in same PDB: d5m0xa2, d5m0xa3
    automated match to d1zy9a1
    complexed with mg, so4

Details for d5m0xa1

PDB Entry: 5m0x (more details), 1.8 Å

PDB Description: structure of apo structure of gh36 alpha-galactosidase from thermotoga maritima
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d5m0xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m0xa1 b.30.5.0 (A:1-177) automated matches {Thermotoga maritima [TaxId: 2336]}
meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvn
nwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsski
ahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmenna

SCOPe Domain Coordinates for d5m0xa1:

Click to download the PDB-style file with coordinates for d5m0xa1.
(The format of our PDB-style files is described here.)

Timeline for d5m0xa1:

  • d5m0xa1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13