SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t5qb_ (5t5q B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2282742Species Brucella abortus [TaxId:359391] [326043] (1 PDB entry)
  8. 2282746Domain d5t5qb_: 5t5q B: [326047]
    automated match to d3op4a_
    complexed with mpd, nad, so4

Details for d5t5qb_

PDB Entry: 5t5q (more details), 1.95 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
PDB Compounds: (B:) Short-chain dehydrogenase/reductase SDR:Glucose/ribitol dehydrogenase

SCOPe Domain Sequences for d5t5qb_:

Sequence, based on SEQRES records: (download)

>d5t5qb_ c.2.1.0 (B:) automated matches {Brucella abortus [TaxId: 359391]}
mkfefenrtlvltganggigraiaelfhasganlvltdldregldafaaslgsperiati
kadassaddaektvalamerfggidflvpsagiyqakpfaemsdadwhrtisinldgvfy
lckralpalkedssivtlaslaayrgayvnahygatkgamvsmtralsrelapktrvngv
spgiietpmtsellktrmdetmtqtplkrlgkpseiasviaflcspaasfvtgetiqvng
giyma

Sequence, based on observed residues (ATOM records): (download)

>d5t5qb_ c.2.1.0 (B:) automated matches {Brucella abortus [TaxId: 359391]}
mkfefenrtlvltganggigraiaelfhasganlvltdldregldafaaslgsperiati
kadassaddaektvalamerfggidflvpsagiyqakpfaemsdadwhrtisinldgvfy
lckralpalkedssivtlaslaayrgayvnahygatkgamvsmtralsrelapktrvngv
spgiiermdetmtqtplkrlgkpseiasviaflcspaasfvtgetiqvnggiyma

SCOPe Domain Coordinates for d5t5qb_:

Click to download the PDB-style file with coordinates for d5t5qb_.
(The format of our PDB-style files is described here.)

Timeline for d5t5qb_:

  • d5t5qb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13