Lineage for d5t5qd_ (5t5q D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (233 species)
    not a true protein
  7. 2282742Species Brucella abortus [TaxId:359391] [326043] (1 PDB entry)
  8. 2282743Domain d5t5qd_: 5t5q D: [326044]
    automated match to d3op4a_
    complexed with mpd, nad, so4

Details for d5t5qd_

PDB Entry: 5t5q (more details), 1.95 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
PDB Compounds: (D:) Short-chain dehydrogenase/reductase SDR:Glucose/ribitol dehydrogenase

SCOPe Domain Sequences for d5t5qd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t5qd_ c.2.1.0 (D:) automated matches {Brucella abortus [TaxId: 359391]}
mkfefenrtlvltganggigraiaelfhasganlvltdldregldafaaslgsperiati
kadassaddaektvalamerfggidflvpsagiyqakpfaemsdadwhrtisinldgvfy
lckralpalkedssivtlaslaayrgayvnahygatkgamvsmtralsrelapktrvngv
spgiietpmtsellktrmdetmtqtplkrlgkpseiasviaflcspaasfvtgetiqvng
giyma

SCOPe Domain Coordinates for d5t5qd_:

Click to download the PDB-style file with coordinates for d5t5qd_.
(The format of our PDB-style files is described here.)

Timeline for d5t5qd_:

  • d5t5qd_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13