SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tdhk_ (5tdh K:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012440Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2012441Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 protein domains)
  6. 2012442Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2012443Species Cow (Bos taurus) [TaxId:9913] [48673] (27 PDB entries)
  8. 2282740Domain d5tdhk_: 5tdh K: [326041]
    Other proteins in same PDB: d5tdhb1, d5tdhb2, d5tdhj1, d5tdhj2
    automated match to d2trcg_
    complexed with gdp; mutant

Details for d5tdhk_

PDB Entry: 5tdh (more details), 3 Å

PDB Description: the crystal structure of the dominant negative mutant g protein alpha(i)-1-beta-1-gamma-2 g203a/a326s
PDB Compounds: (K:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d5tdhk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdhk_ a.137.3.1 (K:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfr

SCOPe Domain Coordinates for d5tdhk_:

Click to download the PDB-style file with coordinates for d5tdhk_.
(The format of our PDB-style files is described here.)

Timeline for d5tdhk_:

  • d5tdhk_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13