SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l63m_ (5l63 M:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (155 PDB entries)
  8. 2282736Domain d5l63m_: 5l63 M: [326037]
    Other proteins in same PDB: d5l63a_, d5l63c_, d5l63d_, d5l63e_, d5l63g_, d5l63i_, d5l63j_, d5l63k_, d5l63l_, d5l63n_, d5l63o_, d5l63q_, d5l63r_, d5l63s_, d5l63u_, d5l63w_, d5l63x_, d5l63y_, d5l63z_
    automated match to d4qz7m_
    complexed with 04c, cl, mes, mg

Details for d5l63m_

PDB Entry: 5l63 (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 17
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5l63m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l63m_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d5l63m_:

Click to download the PDB-style file with coordinates for d5l63m_.
(The format of our PDB-style files is described here.)

Timeline for d5l63m_:

  • d5l63m_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13