Lineage for d5l5tc_ (5l5t C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (14 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2282735Domain d5l5tc_: 5l5t C: [326036]
    Other proteins in same PDB: d5l5ta_, d5l5tb_, d5l5tf_, d5l5tg_, d5l5th_, d5l5ti_, d5l5tj_, d5l5tk_, d5l5tl_, d5l5tm_, d5l5tn_, d5l5to_, d5l5tp_, d5l5tt_, d5l5tu_, d5l5tv_, d5l5tw_, d5l5tx_, d5l5ty_, d5l5tz_
    automated match to d1iruf_
    complexed with 79p, cl, mes, mg

Details for d5l5tc_

PDB Entry: 5l5t (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with epoxyketone inhibitor 16
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l5tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5tc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5l5tc_:

Click to download the PDB-style file with coordinates for d5l5tc_.
(The format of our PDB-style files is described here.)

Timeline for d5l5tc_:

  • d5l5tc_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13