Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d5l5tc1: 5l5t C:1-234 [326036] Other proteins in same PDB: d5l5ta_, d5l5tb_, d5l5tc2, d5l5tf_, d5l5tg_, d5l5th_, d5l5ti_, d5l5tj_, d5l5tk_, d5l5tl_, d5l5tm_, d5l5tn_, d5l5to_, d5l5tp_, d5l5tq2, d5l5tt_, d5l5tu_, d5l5tv_, d5l5tw_, d5l5tx_, d5l5ty_, d5l5tz_ automated match to d1iruf_ complexed with 79p, cl, mes, mg |
PDB Entry: 5l5t (more details), 2.9 Å
SCOPe Domain Sequences for d5l5tc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5tc1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d5l5tc1:
View in 3D Domains from other chains: (mouse over for more information) d5l5ta_, d5l5tb_, d5l5td_, d5l5te_, d5l5tf_, d5l5tg_, d5l5th_, d5l5ti_, d5l5tj_, d5l5tk_, d5l5tl_, d5l5tm_, d5l5tn_, d5l5to_, d5l5tp_, d5l5tq1, d5l5tq2, d5l5tr_, d5l5ts_, d5l5tt_, d5l5tu_, d5l5tv_, d5l5tw_, d5l5tx_, d5l5ty_, d5l5tz_ |