Lineage for d5l63h_ (5l63 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994449Domain d5l63h_: 5l63 H: [326027]
    Other proteins in same PDB: d5l63a_, d5l63c1, d5l63c2, d5l63d_, d5l63e_, d5l63g_, d5l63i_, d5l63j_, d5l63k_, d5l63l_, d5l63n_, d5l63o_, d5l63q1, d5l63q2, d5l63r_, d5l63s_, d5l63u_, d5l63w_, d5l63x_, d5l63y_, d5l63z_
    automated match to d4r17h_
    complexed with 04c, cl, mes, mg

Details for d5l63h_

PDB Entry: 5l63 (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 17
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l63h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l63h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5l63h_:

Click to download the PDB-style file with coordinates for d5l63h_.
(The format of our PDB-style files is described here.)

Timeline for d5l63h_: