Lineage for d5l5tb_ (5l5t B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994817Domain d5l5tb_: 5l5t B: [326024]
    Other proteins in same PDB: d5l5ta_, d5l5tc1, d5l5tc2, d5l5td_, d5l5te_, d5l5tg_, d5l5ti_, d5l5tj_, d5l5tk_, d5l5tl_, d5l5tn_, d5l5to_, d5l5tq1, d5l5tq2, d5l5tr_, d5l5ts_, d5l5tu_, d5l5tw_, d5l5tx_, d5l5ty_, d5l5tz_
    automated match to d1z7qc1
    complexed with 79p, cl, mes, mg

Details for d5l5tb_

PDB Entry: 5l5t (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with epoxyketone inhibitor 16
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5l5tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5tb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5l5tb_:

Click to download the PDB-style file with coordinates for d5l5tb_.
(The format of our PDB-style files is described here.)

Timeline for d5l5tb_: