SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lril_ (5lri L:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2227758Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2227759Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2227760Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. 2227944Protein automated matches [190224] (8 species)
    not a true protein
  7. 2282721Species Rhodobacter sphaeroides [TaxId:272943] [326022] (1 PDB entry)
  8. 2282722Domain d5lril_: 5lri L: [326023]
    Other proteins in same PDB: d5lrih1, d5lrih2, d5lrim_
    automated match to d3dsyl_
    complexed with bcl, bph, cdl, dd9, fe, lda, spn, u10; mutant

Details for d5lril_

PDB Entry: 5lri (more details), 2.4 Å

PDB Description: photosynthetic reaction center mutant with glul212 replaced with trp (chain l, el212w)
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d5lril_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lril_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhwdtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d5lril_:

Click to download the PDB-style file with coordinates for d5lril_.
(The format of our PDB-style files is described here.)

Timeline for d5lril_:

  • d5lril_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13