Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (17 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:272943] [326022] (1 PDB entry) |
Domain d5lril_: 5lri L: [326023] Other proteins in same PDB: d5lrih1, d5lrih2, d5lrim_ automated match to d3dsyl_ complexed with bcl, bph, cdl, dd9, fe, lda, spn, u10; mutant |
PDB Entry: 5lri (more details), 2.4 Å
SCOPe Domain Sequences for d5lril_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lril_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhwdtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d5lril_: