SCOPe 2.08: Domain d5l64r_: 5l64 R:

Lineage for d5l64r_ (5l64 R:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d5l64r_: 5l64 R: [326021]
   Other proteins in same PDB: d5l64a_, d5l64b_, d5l64c2, d5l64f_, d5l64g_, d5l64h_, d5l64i_, d5l64j_, d5l64k_, d5l64l_, d5l64m_, d5l64n_, d5l64o_, d5l64p_, d5l64q2, d5l64t_, d5l64u_, d5l64v_, d5l64w_, d5l64x_, d5l64y_, d5l64z_
   automated match to d1iruf_
   complexed with 6nv, cl, mes, mg

Details for d5l64r_

PDB Entry: 5l64, 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 18

PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5l64r_:

Sequence, based on SEQRES records:

>d5l64r_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records):

>d5l64r_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

Timeline for d5l64r_:

• d5l64r_ first appeared in SCOPe 2.06
  
• d5l64r_ appears in SCOPe 2.07