SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lh3a_ (5lh3 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041900Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2041901Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2041902Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 protein domains)
    automatically mapped to Pfam PF00314
  6. 2041910Protein Thaumatin [49876] (1 species)
  7. 2041911Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (83 PDB entries)
    Uniprot P02883
  8. 2282717Domain d5lh3a_: 5lh3 A: [326018]
    automated match to d1kwna_
    complexed with tla

Details for d5lh3a_

PDB Entry: 5lh3 (more details), 1.64 Å

PDB Description: high dose thaumatin - 0-40 ms.
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d5lh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lh3a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d5lh3a_:

Click to download the PDB-style file with coordinates for d5lh3a_.
(The format of our PDB-style files is described here.)

Timeline for d5lh3a_:

  • d5lh3a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13