Lineage for d5l66c1 (5l66 C:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996196Domain d5l66c1: 5l66 C:1-234 [326017]
    Other proteins in same PDB: d5l66a_, d5l66b_, d5l66c2, d5l66f_, d5l66g_, d5l66h_, d5l66i_, d5l66j_, d5l66k_, d5l66l_, d5l66m_, d5l66n_, d5l66o_, d5l66p_, d5l66q2, d5l66t_, d5l66u_, d5l66v_, d5l66w_, d5l66x_, d5l66y_, d5l66z_
    automated match to d1iruf_
    complexed with bo2, cl, mg

Details for d5l66c1

PDB Entry: 5l66 (more details), 2.8 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with bortezomib
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l66c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l66c1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d5l66c1:

Click to download the PDB-style file with coordinates for d5l66c1.
(The format of our PDB-style files is described here.)

Timeline for d5l66c1: