SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lhfa_ (5lhf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (32 species)
    not a true protein
  7. 2282650Species Thermococcus kodakarensis [TaxId:69014] [325951] (2 PDB entries)
  8. 2282693Domain d5lhfa_: 5lhf A: [325994]
    Other proteins in same PDB: d5lhfb2
    automated match to d1v5xa_
    complexed with cl, na

Details for d5lhfa_

PDB Entry: 5lhf (more details), 1.75 Å

PDB Description: phosphoribosyl anthranilate isomerase from thermococcus kodakaraensis
PDB Compounds: (A:) n-(5'-phosphoribosyl)anthranilate isomerase

SCOPe Domain Sequences for d5lhfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhfa_ c.1.2.0 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mvefvkicgvktmdelrlveryadatgvvvnsrskrkvplktaaeliemaeipiylvstm
ktfpewanavektgaeyiqvhsdmhpkavnrlkdeygvsvmkafmvpresddpaedaerl
leligqyevdkilldtgvgsgrrhdyrvsaiiakeypivlaggltpenvgeairwvkpag
vdvssgverngvkdrvlieafmavvrng

SCOPe Domain Coordinates for d5lhfa_:

Click to download the PDB-style file with coordinates for d5lhfa_.
(The format of our PDB-style files is described here.)

Timeline for d5lhfa_:

  • d5lhfa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13