SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l66d_ (5l66 D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (12 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2282689Domain d5l66d_: 5l66 D: [325990]
    Other proteins in same PDB: d5l66a_, d5l66b_, d5l66f_, d5l66g_, d5l66h_, d5l66i_, d5l66j_, d5l66k_, d5l66l_, d5l66m_, d5l66n_, d5l66o_, d5l66p_, d5l66t_, d5l66u_, d5l66v_, d5l66w_, d5l66x_, d5l66y_, d5l66z_
    automated match to d1iruf_
    complexed with bo2, cl, mg

Details for d5l66d_

PDB Entry: 5l66 (more details), 2.8 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with bortezomib
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5l66d_:

Sequence, based on SEQRES records: (download)

>d5l66d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5l66d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5l66d_:

Click to download the PDB-style file with coordinates for d5l66d_.
(The format of our PDB-style files is described here.)

Timeline for d5l66d_:

  • d5l66d_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13