Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5l63f_: 5l63 F: [325986] Other proteins in same PDB: d5l63a_, d5l63c1, d5l63c2, d5l63d_, d5l63e_, d5l63g_, d5l63i_, d5l63j_, d5l63k_, d5l63l_, d5l63n_, d5l63o_, d5l63q1, d5l63q2, d5l63r_, d5l63s_, d5l63u_, d5l63w_, d5l63x_, d5l63y_, d5l63z_ automated match to d4g4sg_ complexed with 04c, cl, mes, mg |
PDB Entry: 5l63 (more details), 2.7 Å
SCOPe Domain Sequences for d5l63f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l63f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk ein
Timeline for d5l63f_:
View in 3D Domains from other chains: (mouse over for more information) d5l63a_, d5l63b_, d5l63c1, d5l63c2, d5l63d_, d5l63e_, d5l63g_, d5l63h_, d5l63i_, d5l63j_, d5l63k_, d5l63l_, d5l63m_, d5l63n_, d5l63o_, d5l63p_, d5l63q1, d5l63q2, d5l63r_, d5l63s_, d5l63t_, d5l63u_, d5l63v_, d5l63w_, d5l63x_, d5l63y_, d5l63z_ |