Lineage for d5lrim_ (5lri M:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579858Protein M (medium) subunit [81481] (4 species)
  7. 2579929Species Rhodobacter sphaeroides [TaxId:272943] [325983] (1 PDB entry)
  8. 2579930Domain d5lrim_: 5lri M: [325984]
    Other proteins in same PDB: d5lrih1, d5lrih2, d5lril_
    automated match to d1rg5m_
    complexed with bcl, bph, cdl, dd9, fe, lda, spn, u10; mutant

Details for d5lrim_

PDB Entry: 5lri (more details), 2.4 Å

PDB Description: photosynthetic reaction center mutant with glul212 replaced with trp (chain l, el212w)
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d5lrim_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lrim_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 272943]}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnhg

SCOPe Domain Coordinates for d5lrim_:

Click to download the PDB-style file with coordinates for d5lrim_.
(The format of our PDB-style files is described here.)

Timeline for d5lrim_: