SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lrim_ (5lri M:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2227758Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2227759Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2227760Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. 2227847Protein M (medium) subunit [81481] (4 species)
  7. 2282682Species Rhodobacter sphaeroides [TaxId:272943] [325983] (1 PDB entry)
  8. 2282683Domain d5lrim_: 5lri M: [325984]
    Other proteins in same PDB: d5lrih1, d5lrih2, d5lril_
    automated match to d1rg5m_
    complexed with bcl, bph, cdl, dd9, fe, lda, spn, u10; mutant

Details for d5lrim_

PDB Entry: 5lri (more details), 2.4 Å

PDB Description: photosynthetic reaction center mutant with glul212 replaced with trp (chain l, el212w)
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d5lrim_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lrim_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 272943]}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnhg

SCOPe Domain Coordinates for d5lrim_:

Click to download the PDB-style file with coordinates for d5lrim_.
(The format of our PDB-style files is described here.)

Timeline for d5lrim_:

  • d5lrim_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13