SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lsca_ (5lsc A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2205701Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2205847Protein automated matches [190079] (9 species)
    not a true protein
  7. 2205890Species Pseudomonas aeruginosa [TaxId:287] [189349] (28 PDB entries)
  8. 2282680Domain d5lsca_: 5lsc A: [325981]
    automated match to d5a87b_
    complexed with 752, cl, zn

Details for d5lsca_

PDB Entry: 5lsc (more details), 1.5 Å

PDB Description: the structure of the metallo-beta-lactamase vim-2 in complex with a triazolylthioacetamide inhibitor
PDB Compounds: (A:) Metallo-beta-lactamase VIM-2-like protein

SCOPe Domain Sequences for d5lsca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lsca_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawga
kntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegne
ipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsag
nvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsv

SCOPe Domain Coordinates for d5lsca_:

Click to download the PDB-style file with coordinates for d5lsca_.
(The format of our PDB-style files is described here.)

Timeline for d5lsca_:

  • d5lsca_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13