SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lrih2 (5lri H:36-249)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2052955Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2052956Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2052957Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2052958Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2282676Species Rhodobacter sphaeroides [TaxId:272943] [325977] (1 PDB entry)
  8. 2282677Domain d5lrih2: 5lri H:36-249 [325978]
    Other proteins in same PDB: d5lrih1, d5lril_, d5lrim_
    automated match to d1qovh1
    complexed with bcl, bph, cdl, dd9, fe, lda, spn, u10; mutant

Details for d5lrih2

PDB Entry: 5lri (more details), 2.4 Å

PDB Description: photosynthetic reaction center mutant with glul212 replaced with trp (chain l, el212w)
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d5lrih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lrih2 b.41.1.1 (H:36-249) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 272943]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrk

SCOPe Domain Coordinates for d5lrih2:

Click to download the PDB-style file with coordinates for d5lrih2.
(The format of our PDB-style files is described here.)

Timeline for d5lrih2:

  • d5lrih2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5lrih1