Lineage for d5lrih2 (5lri H:36-249)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2052955Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2052956Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2052957Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2052958Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2282676Species Rhodobacter sphaeroides [TaxId:272943] [325977] (1 PDB entry)
  8. 2282677Domain d5lrih2: 5lri H:36-249 [325978]
    Other proteins in same PDB: d5lrih1, d5lril_, d5lrim_
    automated match to d1qovh1
    complexed with bcl, bph, cdl, dd9, fe, lda, spn, u10; mutant

Details for d5lrih2

PDB Entry: 5lri (more details), 2.4 Å

PDB Description: photosynthetic reaction center mutant with glul212 replaced with trp (chain l, el212w)
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d5lrih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lrih2 b.41.1.1 (H:36-249) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 272943]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrk

SCOPe Domain Coordinates for d5lrih2:

Click to download the PDB-style file with coordinates for d5lrih2.
(The format of our PDB-style files is described here.)

Timeline for d5lrih2:

  • d5lrih2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5lrih1