Lineage for d5lhea_ (5lhe A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2282650Species Thermococcus kodakarensis [TaxId:69014] [325951] (2 PDB entries)
  8. 2282651Domain d5lhea_: 5lhe A: [325952]
    automated match to d1v5xa_
    complexed with na

Details for d5lhea_

PDB Entry: 5lhe (more details), 1.85 Å

PDB Description: phosphoribosyl anthranilate isomerase from thermococcus kodakaraensis
PDB Compounds: (A:) n-(5'-phosphoribosyl)anthranilate isomerase

SCOPe Domain Sequences for d5lhea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhea_ c.1.2.0 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
vefvkicgvktmdelrlveryadatgvvvnsrskrkvplktaaeliemaeipiylvstmk
tfpewanavektgaeyiqvhsdmhpkavnrlkdeygvsvmkafmvpresddpaedaerll
eligqyevdkilldtgvgsgrrhdyrvsaiiakeypivlaggltpenvgeairwvkpagv
dvssgverngvkdrvlieafmavvrng

SCOPe Domain Coordinates for d5lhea_:

Click to download the PDB-style file with coordinates for d5lhea_.
(The format of our PDB-style files is described here.)

Timeline for d5lhea_:

  • d5lhea_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13