Lineage for d5lh5a_ (5lh5 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041900Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2041901Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2041902Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 protein domains)
    automatically mapped to Pfam PF00314
  6. 2041910Protein Thaumatin [49876] (1 species)
  7. 2041911Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (88 PDB entries)
    Uniprot P02883
  8. 2282639Domain d5lh5a_: 5lh5 A: [325940]
    automated match to d1kwna_
    complexed with tla

Details for d5lh5a_

PDB Entry: 5lh5 (more details), 1.69 Å

PDB Description: high dose thaumatin - 40-80 ms.
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d5lh5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lh5a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d5lh5a_:

Click to download the PDB-style file with coordinates for d5lh5a_.
(The format of our PDB-style files is described here.)

Timeline for d5lh5a_:

  • d5lh5a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13