SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5llic_ (5lli C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2034948Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2034949Family b.3.3.1: VHL [49469] (2 protein domains)
  6. 2034950Protein VHL [49470] (1 species)
  7. 2034951Species Human (Homo sapiens) [TaxId:9606] [49471] (19 PDB entries)
  8. 2282628Domain d5llic_: 5lli C: [325929]
    Other proteins in same PDB: d5llia_, d5llib1, d5llib2, d5llid_, d5llie1, d5llie2, d5llig_, d5llih1, d5llih2, d5llij_, d5llik1, d5llik2
    automated match to d1lqbc_
    complexed with 6z3

Details for d5llic_

PDB Entry: 5lli (more details), 2.4 Å

PDB Description: pvhl:elob:eloc in complex with vh298
PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5llic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llic_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltq

SCOPe Domain Coordinates for d5llic_:

Click to download the PDB-style file with coordinates for d5llic_.
(The format of our PDB-style files is described here.)

Timeline for d5llic_:

  • d5llic_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13