Lineage for d5l60s_ (5l60 S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996166Domain d5l60s_: 5l60 S: [325914]
    Other proteins in same PDB: d5l60a_, d5l60b_, d5l60c2, d5l60f_, d5l60h_, d5l60i_, d5l60j_, d5l60k_, d5l60l_, d5l60m_, d5l60n_, d5l60o_, d5l60p_, d5l60q2, d5l60t_, d5l60v_, d5l60w_, d5l60x_, d5l60y_, d5l60z_
    automated match to d4g4se_
    complexed with 39v, cl, mes, mg

Details for d5l60s_

PDB Entry: 5l60 (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with pr-924
PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l60s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l60s_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5l60s_:

Click to download the PDB-style file with coordinates for d5l60s_.
(The format of our PDB-style files is described here.)

Timeline for d5l60s_: