Lineage for d5l60t_ (5l60 T:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229504Domain d5l60t_: 5l60 T: [325898]
    Other proteins in same PDB: d5l60a_, d5l60c_, d5l60d_, d5l60e_, d5l60g_, d5l60i_, d5l60j_, d5l60k_, d5l60l_, d5l60o_, d5l60q_, d5l60r_, d5l60s_, d5l60u_, d5l60w_, d5l60x_, d5l60y_, d5l60z_
    automated match to d4g4sg_
    complexed with 39v, cl, mes, mg

Details for d5l60t_

PDB Entry: 5l60 (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with pr-924
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l60t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l60t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5l60t_:

Click to download the PDB-style file with coordinates for d5l60t_.
(The format of our PDB-style files is described here.)

Timeline for d5l60t_: