![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
![]() | Protein automated matches [190509] (15 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
![]() | Domain d5l65s_: 5l65 S: [325879] Other proteins in same PDB: d5l65a_, d5l65b_, d5l65f_, d5l65g_, d5l65h_, d5l65i_, d5l65j_, d5l65k_, d5l65l_, d5l65m_, d5l65n_, d5l65o_, d5l65p_, d5l65t_, d5l65u_, d5l65v_, d5l65w_, d5l65x_, d5l65y_, d5l65z_ automated match to d4g4se_ complexed with 3bv, cl, mes, mg |
PDB Entry: 5l65 (more details), 2.9 Å
SCOPe Domain Sequences for d5l65s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l65s_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
Timeline for d5l65s_: