SCOPe 2.07: Domain d5l6ct_: 5l6c T:

Lineage for d5l6ct_ (5l6c T:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)

8. Domain d5l6ct_: 5l6c T: [325869]
   Other proteins in same PDB: d5l6ca_, d5l6cc_, d5l6cd_, d5l6ce_, d5l6cg_, d5l6ci_, d5l6cj_, d5l6ck_, d5l6cl_, d5l6cn_, d5l6co_, d5l6cq_, d5l6cr_, d5l6cs_, d5l6cu_, d5l6cw_, d5l6cx_, d5l6cy_, d5l6cz_
   automated match to d4g4sg_
   complexed with 6nv, cl, mes, mg

Details for d5l6ct_

PDB Entry: 5l6c, 2.6 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 18

PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l6ct_:

Sequence; same for both SEQRES and ATOM records:

>d5l6ct_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d5l6ct_:

• d5l6ct_ first appeared in SCOPe 2.06