Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d5l6ar_: 5l6a R: [325865] Other proteins in same PDB: d5l6aa_, d5l6ab_, d5l6ac2, d5l6af_, d5l6ag_, d5l6ah_, d5l6ai_, d5l6aj_, d5l6ak_, d5l6al_, d5l6am_, d5l6an_, d5l6ao_, d5l6ap_, d5l6aq2, d5l6at_, d5l6au_, d5l6av_, d5l6aw_, d5l6ax_, d5l6ay_, d5l6az_ automated match to d1iruf_ complexed with 79l, cl, mes, mg |
PDB Entry: 5l6a (more details), 2.8 Å
SCOPe Domain Sequences for d5l6ar_:
Sequence, based on SEQRES records: (download)
>d5l6ar_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
>d5l6ar_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
Timeline for d5l6ar_:
View in 3D Domains from other chains: (mouse over for more information) d5l6aa_, d5l6ab_, d5l6ac1, d5l6ac2, d5l6ad_, d5l6ae_, d5l6af_, d5l6ag_, d5l6ah_, d5l6ai_, d5l6aj_, d5l6ak_, d5l6al_, d5l6am_, d5l6an_, d5l6ao_, d5l6ap_, d5l6aq1, d5l6aq2, d5l6as_, d5l6at_, d5l6au_, d5l6av_, d5l6aw_, d5l6ax_, d5l6ay_, d5l6az_ |