SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l6ag_ (5l6a G:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2201421Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2201437Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2282556Domain d5l6ag_: 5l6a G: [325857]
    Other proteins in same PDB: d5l6aa_, d5l6ab_, d5l6ac_, d5l6ad_, d5l6ae_, d5l6af_, d5l6ah_, d5l6ai_, d5l6aj_, d5l6am_, d5l6an_, d5l6ao_, d5l6ap_, d5l6aq_, d5l6ar_, d5l6as_, d5l6at_, d5l6av_, d5l6aw_, d5l6ax_
    automated match to d1g0ug_
    complexed with 79l, cl, mes, mg

Details for d5l6ag_

PDB Entry: 5l6a (more details), 2.8 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 17
PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d5l6ag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l6ag_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d5l6ag_:

Click to download the PDB-style file with coordinates for d5l6ag_.
(The format of our PDB-style files is described here.)

Timeline for d5l6ag_:

  • d5l6ag_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13