Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5l60m_: 5l60 M: [325853] Other proteins in same PDB: d5l60a_, d5l60c1, d5l60c2, d5l60d_, d5l60e_, d5l60g_, d5l60i_, d5l60j_, d5l60k_, d5l60l_, d5l60o_, d5l60q1, d5l60q2, d5l60r_, d5l60s_, d5l60u_, d5l60w_, d5l60x_, d5l60y_, d5l60z_ automated match to d4qz7m_ complexed with 39v, cl, mes, mg |
PDB Entry: 5l60 (more details), 2.7 Å
SCOPe Domain Sequences for d5l60m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l60m_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d5l60m_:
View in 3D Domains from other chains: (mouse over for more information) d5l60a_, d5l60b_, d5l60c1, d5l60c2, d5l60d_, d5l60e_, d5l60f_, d5l60g_, d5l60h_, d5l60i_, d5l60j_, d5l60k_, d5l60l_, d5l60n_, d5l60o_, d5l60p_, d5l60q1, d5l60q2, d5l60r_, d5l60s_, d5l60t_, d5l60u_, d5l60v_, d5l60w_, d5l60x_, d5l60y_, d5l60z_ |