Lineage for d5l6cm_ (5l6c M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994179Domain d5l6cm_: 5l6c M: [325849]
    Other proteins in same PDB: d5l6ca_, d5l6cc1, d5l6cc2, d5l6cd_, d5l6ce_, d5l6cg_, d5l6ci_, d5l6cj_, d5l6ck_, d5l6cl_, d5l6cn_, d5l6co_, d5l6cq1, d5l6cq2, d5l6cr_, d5l6cs_, d5l6cu_, d5l6cw_, d5l6cx_, d5l6cy_, d5l6cz_
    automated match to d4qz7m_
    complexed with 6nv, cl, mes, mg

Details for d5l6cm_

PDB Entry: 5l6c (more details), 2.6 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 18
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5l6cm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l6cm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d5l6cm_:

Click to download the PDB-style file with coordinates for d5l6cm_.
(The format of our PDB-style files is described here.)

Timeline for d5l6cm_: