SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l61f_ (5l61 F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (155 PDB entries)
  8. 2282533Domain d5l61f_: 5l61 F: [325834]
    Other proteins in same PDB: d5l61a_, d5l61c_, d5l61d_, d5l61e_, d5l61g_, d5l61i_, d5l61j_, d5l61k_, d5l61l_, d5l61n_, d5l61o_, d5l61q_, d5l61r_, d5l61s_, d5l61u_, d5l61w_, d5l61x_, d5l61y_, d5l61z_
    automated match to d4g4sg_
    complexed with 6n5, cl, mes, mg

Details for d5l61f_

PDB Entry: 5l61 (more details), 2.8 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (99- 132) in complex with epoxyketone inhibitor 14
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l61f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l61f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5l61f_:

Click to download the PDB-style file with coordinates for d5l61f_.
(The format of our PDB-style files is described here.)

Timeline for d5l61f_:

  • d5l61f_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13