Lineage for d5l61e_ (5l61 E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (14 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2282528Domain d5l61e_: 5l61 E: [325829]
    Other proteins in same PDB: d5l61a_, d5l61b_, d5l61f_, d5l61g_, d5l61h_, d5l61i_, d5l61j_, d5l61k_, d5l61l_, d5l61m_, d5l61n_, d5l61o_, d5l61p_, d5l61t_, d5l61u_, d5l61v_, d5l61w_, d5l61x_, d5l61y_, d5l61z_
    automated match to d4g4se_
    complexed with 6n5, cl, mes, mg

Details for d5l61e_

PDB Entry: 5l61 (more details), 2.8 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (99- 132) in complex with epoxyketone inhibitor 14
PDB Compounds: (E:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l61e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l61e_ d.153.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5l61e_:

Click to download the PDB-style file with coordinates for d5l61e_.
(The format of our PDB-style files is described here.)

Timeline for d5l61e_:

  • d5l61e_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12