SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l5js_ (5l5j S:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2282494Domain d5l5js_: 5l5j S: [325795]
    Other proteins in same PDB: d5l5ja_, d5l5jb_, d5l5jc_, d5l5jd_, d5l5jf_, d5l5jg_, d5l5ji_, d5l5jj_, d5l5jk_, d5l5jl_, d5l5jn_, d5l5jo_, d5l5jp_, d5l5jq_, d5l5jr_, d5l5jt_, d5l5ju_, d5l5jw_, d5l5jx_, d5l5jy_, d5l5jz_
    automated match to d4g4se_
    complexed with 6n5, cl, mes, mg

Details for d5l5js_

PDB Entry: 5l5j (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 14
PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l5js_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5js_ d.153.1.4 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5l5js_:

Click to download the PDB-style file with coordinates for d5l5js_.
(The format of our PDB-style files is described here.)

Timeline for d5l5js_:

  • d5l5js_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12