Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5l5zm_: 5l5z M: [325787] Other proteins in same PDB: d5l5za_, d5l5zc1, d5l5zc2, d5l5zd_, d5l5ze_, d5l5zg_, d5l5zi_, d5l5zj_, d5l5zk_, d5l5zl_, d5l5zn_, d5l5zo_, d5l5zq1, d5l5zq2, d5l5zr_, d5l5zs_, d5l5zu_, d5l5zw_, d5l5zx_, d5l5zy_, d5l5zz_ automated match to d4qz7m_ complexed with bo2, cl, mg |
PDB Entry: 5l5z (more details), 2.7 Å
SCOPe Domain Sequences for d5l5zm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5zm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d5l5zm_:
View in 3D Domains from other chains: (mouse over for more information) d5l5za_, d5l5zb_, d5l5zc1, d5l5zc2, d5l5zd_, d5l5ze_, d5l5zf_, d5l5zg_, d5l5zh_, d5l5zi_, d5l5zj_, d5l5zk_, d5l5zl_, d5l5zn_, d5l5zo_, d5l5zp_, d5l5zq1, d5l5zq2, d5l5zr_, d5l5zs_, d5l5zt_, d5l5zu_, d5l5zv_, d5l5zw_, d5l5zx_, d5l5zy_, d5l5zz_ |