Lineage for d5l5sa_ (5l5s A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2202517Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2202526Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2282479Domain d5l5sa_: 5l5s A: [325780]
    Other proteins in same PDB: d5l5sb_, d5l5sc_, d5l5sd_, d5l5se_, d5l5sf_, d5l5sg_, d5l5sh_, d5l5sk_, d5l5sl_, d5l5sm_, d5l5sp_, d5l5sq_, d5l5sr_, d5l5ss_, d5l5st_, d5l5su_, d5l5sv_, d5l5sy_, d5l5sz_
    automated match to d1jd2v_
    complexed with 39v, cl, mg

Details for d5l5sa_

PDB Entry: 5l5s (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with pr-924
PDB Compounds: (A:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d5l5sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5sa_ d.153.1.4 (A:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d5l5sa_:

Click to download the PDB-style file with coordinates for d5l5sa_.
(The format of our PDB-style files is described here.)

Timeline for d5l5sa_:

  • d5l5sa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12