Lineage for d5l54m_ (5l54 M:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229730Domain d5l54m_: 5l54 M: [325757]
    Other proteins in same PDB: d5l54a_, d5l54b_, d5l54c_, d5l54d_, d5l54f_, d5l54g_, d5l54i_, d5l54j_, d5l54k_, d5l54l_, d5l54n_, d5l54o_, d5l54p_, d5l54q_, d5l54r_, d5l54t_, d5l54u_, d5l54w_, d5l54x_, d5l54y_, d5l54z_
    automated match to d4qz7m_
    complexed with 79p, cl, mes, mg

Details for d5l54m_

PDB Entry: 5l54 (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with epoxyketone inhibitor 16
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5l54m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l54m_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d5l54m_:

Click to download the PDB-style file with coordinates for d5l54m_.
(The format of our PDB-style files is described here.)

Timeline for d5l54m_: