Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d5l54m_: 5l54 M: [325757] Other proteins in same PDB: d5l54a_, d5l54b_, d5l54c_, d5l54d_, d5l54f_, d5l54g_, d5l54i_, d5l54j_, d5l54k_, d5l54l_, d5l54n_, d5l54o_, d5l54p_, d5l54q_, d5l54r_, d5l54t_, d5l54u_, d5l54w_, d5l54x_, d5l54y_, d5l54z_ automated match to d4qz7m_ complexed with 79p, cl, mes, mg |
PDB Entry: 5l54 (more details), 2.8 Å
SCOPe Domain Sequences for d5l54m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l54m_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d5l54m_: