Lineage for d5l5ji_ (5l5j I:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2550699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (175 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2552454Domain d5l5ji_: 5l5j I: [325756]
    Other proteins in same PDB: d5l5jb_, d5l5jc_, d5l5jd_, d5l5je_, d5l5jf_, d5l5jg_, d5l5jh_, d5l5jk_, d5l5jl_, d5l5jp_, d5l5jq_, d5l5jr_, d5l5js_, d5l5jt_, d5l5ju_, d5l5jv_, d5l5jy_, d5l5jz_
    automated match to d1g0ui_
    complexed with 6n5, cl, mes, mg

Details for d5l5ji_

PDB Entry: 5l5j (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 14
PDB Compounds: (I:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d5l5ji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5ji_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d5l5ji_:

Click to download the PDB-style file with coordinates for d5l5ji_.
(The format of our PDB-style files is described here.)

Timeline for d5l5ji_: